Poliovirus Receptor (PVR) (NM_001135769) Human Mass Spec Standard
CAT#: PH327222
PVR MS Standard C13 and N15-labeled recombinant protein (NP_001129241)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227222 |
Predicted MW | 39.1 kDa |
Protein Sequence |
>RC227222 representing NM_001135769
Red=Cloning site Green=Tags(s) MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHG ESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLR VLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVP SSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWS TTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKGTEHASASANGHVSYSAVSR ENSSSQDPQTEGTR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001129241 |
RefSeq ORF | 1092 |
Synonyms | CD155; HVED; Necl-5; NECL5; PVS; TAGE4 |
Locus ID | 5817 |
UniProt ID | P15151 |
Cytogenetics | 19q13.31 |
Summary | 'The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]' |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401951 | PVR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427700 | PVR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427701 | PVR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401951 | Transient overexpression lysate of poliovirus receptor (PVR), transcript variant 1 |
USD 396.00 |
|
LY427700 | Transient overexpression lysate of poliovirus receptor (PVR), transcript variant 2 |
USD 396.00 |
|
LY427701 | Transient overexpression lysate of poliovirus receptor (PVR), transcript variant 3 |
USD 396.00 |
|
TP327222 | Purified recombinant protein of Homo sapiens poliovirus receptor (PVR), transcript variant 3 |
USD 399.00 |
|
TP720486 | Recombinant protein of human poliovirus receptor (PVR), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review