FXYD3 (NM_001136011) Human Mass Spec Standard
CAT#: PH327235
FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_001129483)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227235 |
Predicted MW | 9.3 kDa |
Protein Sequence |
>RC227235 protein sequence
Red=Cloning site Green=Tags(s) MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSG HHPGETPPLITPGSAQS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001129483 |
RefSeq Size | 1466 |
RefSeq ORF | 261 |
Synonyms | MAT8; PLML |
Locus ID | 5349 |
UniProt ID | Q14802 |
Cytogenetics | 19q13.12 |
Summary | 'This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2008]' |
Protein Families | Ion Channels: Other, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411880 | FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC416954 | FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427762 | FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427763 | FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411880 | Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 2 |
USD 396.00 |
|
LY416954 | Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1 |
USD 396.00 |
|
LY427762 | Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 7 |
USD 396.00 |
|
LY427763 | Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 8 |
USD 396.00 |
|
PH313945 | FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_005962) |
USD 2,055.00 |
|
PH327269 | FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_001129484) |
USD 2,055.00 |
|
TP313945 | Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1 |
USD 748.00 |
|
TP327235 | Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 7 |
USD 748.00 |
|
TP327269 | Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 8 |
USD 748.00 |
|
TP761868 | Purified recombinant protein of Human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review