FXYD3 (NM_001136012) Human Mass Spec Standard

CAT#: PH327269

FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_001129484)

Product Images

Coomassie blue staining of purified FXYD3 protein (Cat# TP327269). The protein was produced from HEK293T cells transfected with FXYD3 cDNA clone (Cat# RC227269) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227269
• Predicted MW: 11.99 kDa
• Protein Sequence:
  Sequence Link

  >RC227269 representing NM_001136012
  Red=Cloning site Green=Tags(s)
  
  MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSEWRSSGEQAGRG
  WGSPPLTTQLSPTGAKCKCKFGQKSGHHPGETPPLITPGSAQS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001129484
• RefSeq ORF: 339
• Synonyms: MAT8; PLML
• Locus ID: 5349
• UniProt ID: Q14802
• Cytogenetics: 19q13.12
• Summary: 'This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2008]'
• Protein Families: Ion Channels: Other, Transmembrane