ECSIT (NM_001142465) Human Mass Spec Standard

CAT#: PH327595

ECSIT MS Standard C13 and N15-labeled recombinant protein (NP_001135937)

Product Images

Coomassie blue staining of purified ECSIT protein (Cat# TP327595). The protein was produced from HEK293T cells transfected with ECSIT cDNA clone (Cat# RC227595) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227595
• Predicted MW: 24 kDa
• Protein Sequence:
  Sequence Link

  >RC227595 representing NM_001142465
  Red=Cloning site Green=Tags(s)
  
  MSWVQATLLARGLCRAWGGTCGAALTGTSISQVPLPKDSTGAADPPQPHIVGIQSPDQQAALARHNPARP
  VFVEGPFSLWLRNKCVYYHILRADLLPPEEREVEETPEEWNLYYPMQLDLEYVRSGWDNYEFDINEVEEG
  PVFAMCMAGAHDQATMAKWIQGLQETNPTLAQIPVVFRLAGSTRELQTSSAGLEEPPLPEDHQEEDDNLQ
  RQQQGQS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001135937
• RefSeq ORF: 651
• Synonyms: SITPEC
• Locus ID: 51295
• UniProt ID: Q9BQ95
• Cytogenetics: 19p13.2
• Summary: Required for efficient assembly of mitochondrial NADH:ubiquinone oxidoreductase. [UniProtKB/Swiss-Prot Function]
• Protein Pathways: MAPK signaling pathway