SSPN (NM_001135823) Human Mass Spec Standard

CAT#: PH327888

SSPN MS Standard C13 and N15-labeled recombinant protein (NP_001129295)

Product Images

Coomassie blue staining of purified SSPN protein (Cat# TP327888). The protein was produced from HEK293T cells transfected with SSPN cDNA clone (Cat# RC227888) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227888
• Predicted MW: 26.62 kDa
• Protein Sequence:
  Sequence Link

  >RC227888 representing NM_001135823
  Red=Cloning site Green=Tags(s)
  
  MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVV
  GFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAV
  AFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCL
  LACFVMWKHRYQVFYVGVRICSLTASEGPQQKI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001129295
• RefSeq ORF: 729
• Synonyms: DAGA5; KRAG; NSPN; SPN1; SPN2
• Locus ID: 8082
• UniProt ID: Q14714
• Cytogenetics: 12p12.1
• Summary: This gene encodes a member of the dystrophin-glycoprotein complex (DGC). The DGC spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Two alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Oct 2008]
• Protein Families: Druggable Genome, Transmembrane