GKAP1 (NM_001135953) Human Mass Spec Standard

CAT#: PH327915

GKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001129425)

Product Images

Coomassie blue staining of purified GKAP1 protein (Cat# TP327915). The protein was produced from HEK293T cells transfected with GKAP1 cDNA clone (Cat# RC227915) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227915
• Predicted MW: 35.9 kDa
• Protein Sequence:
  Sequence Link

  >RC227915 representing NM_001135953
  Red=Cloning site Green=Tags(s)
  
  MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEA
  NELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLE
  YEEHKKEYEDAENTSTQSKVMNKKDKRKNHQGKDRPLTVSLKDFHSEDHISKKTEEVVLKDGRIERLKLE
  LERKDAEIQKLKNVITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHA
  ALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001129425
• RefSeq ORF: 945
• Synonyms: FKSG21; GKAP42
• Locus ID: 80318
• UniProt ID: Q5VSY0
• Cytogenetics: 9q21.32
• Summary: This gene encodes a protein that is highly similar to the mouse cGMP-dependent protein kinase anchoring protein 42kDa. The mouse protein has been found to localize with the Golgi and recruit cGMP-dependent protein kinase I alpha to the Golgi in mouse testes. It is thought to play a role in germ cell development. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
• Protein Families: Druggable Genome