GKAP1 (NM_001135953) Human Mass Spec Standard
CAT#: PH327915
GKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001129425)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227915 |
Predicted MW | 35.9 kDa |
Protein Sequence |
>RC227915 representing NM_001135953
Red=Cloning site Green=Tags(s) MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEA NELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLE YEEHKKEYEDAENTSTQSKVMNKKDKRKNHQGKDRPLTVSLKDFHSEDHISKKTEEVVLKDGRIERLKLE LERKDAEIQKLKNVITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHA ALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001129425 |
RefSeq ORF | 945 |
Synonyms | FKSG21; GKAP42 |
Locus ID | 80318 |
UniProt ID | Q5VSY0 |
Cytogenetics | 9q21.32 |
Summary | This gene encodes a protein that is highly similar to the mouse cGMP-dependent protein kinase anchoring protein 42kDa. The mouse protein has been found to localize with the Golgi and recruit cGMP-dependent protein kinase I alpha to the Golgi in mouse testes. It is thought to play a role in germ cell development. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410835 | GKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427741 | GKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410835 | Transient overexpression lysate of G kinase anchoring protein 1 (GKAP1), transcript variant 1 |
USD 396.00 |
|
LY427741 | Transient overexpression lysate of G kinase anchoring protein 1 (GKAP1), transcript variant 2 |
USD 396.00 |
|
PH304911 | GKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_079487) |
USD 2,055.00 |
|
TP304911 | Recombinant protein of human G kinase anchoring protein 1 (GKAP1), transcript variant 1 |
USD 823.00 |
|
TP327915 | Purified recombinant protein of Homo sapiens G kinase anchoring protein 1 (GKAP1), transcript variant 2 |
USD 748.00 |
|
TP761516 | Purified recombinant protein of Human G kinase anchoring protein 1 (GKAP1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review