VEGF-C / Flt4-L Human Protein
Other products for "Vegfc"
Specifications
Product Data | |
Species | Human |
Expression Host | Insect |
Expression cDNA Clone or AA Sequence |
DPTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVT ISFANHTSCRCMSKLHHHHHH
|
Predicted MW | 18-24 kDa |
Purity | >90% pure by SDS-PAGE and visualised by silver stain |
Buffer | Presentation State: Purified State: Lyophilized protein Buffer System: PBS containing BSA (50-fold) as stabilizer |
Bioactivity | Biological: Determined (i) by the ability to induce VEGFR-3/FLT-4 receptor phosphorylation in PAEC/VEGFR-3 cells and (ii) the VEGF-C-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC). |
Endotoxin | < 0.1 ng per µg of VEGF-C |
Reconstitution | Restore in PBS or medium to a concentration not lower than 50 µg/ml. |
Preparation | Lyophilized protein |
Protein Description | The recombinant Human VEGF-C contains 129 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions. |
Storage | Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing. |
Stability | Shelf life: one year from despatch. |
Reference Data | |
RefSeq | NP_446105 |
Locus ID | 114111 |
UniProt ID | O35757 |
Cytogenetics | 16p11 |
Summary | platelet-derived growth factor/vascular derived growth factor (PDGF/VEGF); active in angiogenesis and endothelial cell growth [RGD, Feb 2006] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.