VEGF-C / Flt4-L Human Protein

CAT#: AR01001PU-N

VEGF-C / Flt4-L human recombinant protein, 20 µg


USD 290.00

2 Weeks*

Size
    • 20 ug

Product Images

Other products for "Vegfc"

Specifications

Product Data
Species Human
Expression Host Insect
Expression cDNA Clone or AA Sequence
DPTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVT ISFANHTSCRCMSKLHHHHHH
Predicted MW 18-24 kDa
Purity >90% pure by SDS-PAGE and visualised by silver stain
Buffer Presentation State: Purified
State: Lyophilized protein
Buffer System: PBS containing BSA (50-fold) as stabilizer
Bioactivity Biological: Determined (i) by the ability to induce VEGFR-3/FLT-4 receptor phosphorylation in PAEC/VEGFR-3 cells and (ii) the VEGF-C-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC).
Endotoxin < 0.1 ng per µg of VEGF-C
Reconstitution Restore in PBS or medium to a concentration not lower than 50 µg/ml.
Preparation Lyophilized protein
Protein Description The recombinant Human VEGF-C contains 129 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Stability Shelf life: one year from despatch.
Reference Data
RefSeq NP_446105
Locus ID 114111
UniProt ID O35757
Cytogenetics 16p11
Summary platelet-derived growth factor/vascular derived growth factor (PDGF/VEGF); active in angiogenesis and endothelial cell growth [RGD, Feb 2006]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.