GM-CSF Mouse Protein

CAT#: AR26006PU-L

GM-CSF mouse recombinant protein, 50 µg

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
• Predicted MW: 14,24 kDa
• Purity: >95% by SDS-PAGE & Silver staining
• Buffer: Presentation State: Purified
  State: Lyophilized protein
  Buffer System: 50mM acetic acid without stabilizer
• Endotoxin: < 0.1 ng per μg of GM-CSF
• Reconstitution: Mouse GM-CSF should be reconstituted in 50mM acetic acid or water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions.
• Preparation: Lyophilized protein
• Protein Description: Mouse recombinant GM-CSF, aa. 125
• Note: Protein RefSeq: NP_035954.1
  mRNA RefSeq: NM_011824
• Storage: The lyophilized antibody can be stored at room temperature for up to two weeks, or desiccated at -20 °C for longer. Following reconstitution store in aliquots at -20 °C. Avoid repeated freezing and thawing.
• Stability: Shelf life: one year from despatch.

Reference Data

• RefSeq: NP_034099
• Locus ID: 12981
• UniProt ID: P01587, Q5SX78
• Cytogenetics: 11 32.13 cM
• Synonyms: CSF; Csfgm; Gm-CSf; GMCSF; MGI-IGM
• Summary: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [UniProtKB/Swiss-Prot Function]