VEGF-A (VEGF120) Mouse Protein

CAT#: AR26013PU-N

VEGF-A (VEGF120) mouse recombinant protein, 5 µg


USD 260.00

2 Weeks*

Size
    • 5 ug

Product Images

Other products for "Vegfa"

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
Predicted MW 28.2 kDa
Purity >95% by SDS-PAGE and silver stain
Buffer Presentation State: Purified
State: Lyophilized protein
Buffer System: 50 mM Acetic Acid
Stabilizer: None
Bioactivity Biological: Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1-10 ng/ml.
Endotoxin < 0.1 ng/µg of VEGF120
Reconstitution The lyophilized VEGF120 is soluble in water and most aqueous buffers. The lyophilized VEGF120 should be reconstituted in 50mM acetic acid or medium containing at least 0.1% human or bovine serum albumin to a concentration not lower than 50μg/ml.
Preparation Lyophilized protein
Protein Description Recombinant Murine Vascular Endothelial Growth Factor120
Note Range: 1.0-10.0 ng/ml
Protein RefSeq: NP 001020421
mRNA RefSeq: NM 001025250
Storage The lyophilized protein is stable at 2-8°C for up to 1 week or at -20°C for longer.
Following reconstitution store (in aliquots) at -20°C.
Avoid repeated freezing and thawing.
Stability Shelf life: one year from despatch.
Reference Data
RefSeq NP_001020421
Locus ID 22339
UniProt ID Q00731, A0A1L1SVG2
Cytogenetics 17 22.79 cM
Synonyms Vegf; Vpf
Summary This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. [provided by RefSeq, Nov 2015]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.