VEGF-A (VEGF164) Rat Protein

CAT#: AR31052PU-L

VEGF-A (VEGF164) rat recombinant protein, 20 µg

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
  Result by N-terminal sequencing: APTTEGEQKAH
• Predicted MW: 19.23 kDa
• Purity: >95%
• Buffer: Presentation State: Purified
  State: Lyophilized freeze dried protein
  Buffer System: PBS without stabilizer
• Bioactivity: Biological: Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 2-10 ng/ml.
• Endotoxin: < 0.1 ng/µg of Rat VEGF164
• Reconstitution: The lyophilized VEGF164 should be restored in ddH2O to a concentration not lower than 50 μg/ml.
• Preparation: Lyophilized freeze dried protein
• Protein Description: Recombinant Rat Vascular Endothelial Growth Factor 164
• Storage: Lyophilized samples are stable for greater than six months at –20°C to -70°C.
  Reconstituted VEGF164 should be stored in working aliquots at -20°C.
  Avoid repeated freeze-thaw cycles!
• Stability: Stable for at least 3 months from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001103803
• Locus ID: 83785
• UniProt ID: B5DEK7
• Cytogenetics: 9q12
• Synonyms: Vegf; VEGF-A; VEGF111; VEGF164; VPF
• Summary: This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. [provided by RefSeq, Nov 2015]