VEGF-A (VEGF164) Rat Protein

CAT#: AR31052PU-N

VEGF-A (VEGF164) rat recombinant protein, 5 µg


USD 220.00

2 Weeks*

Size
    • 5 ug

Product Images

Other products for "Vegfa"

Specifications

Product Data
Species Rat
Expression Host E. coli
Expression cDNA Clone or AA Sequence
APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
Result by N-terminal sequencing: APTTEGEQKAH
Predicted MW 19.23 kDa
Purity >95%
Buffer Presentation State: Purified
State: Lyophilized freeze dried protein
Buffer System: PBS without stabilizer
Bioactivity Biological: Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 2-10 ng/ml.
Endotoxin < 0.1 ng/µg of Rat VEGF164
Reconstitution The lyophilized VEGF164 should be restored in ddH2O to a concentration not lower than 50 μg/ml.
Preparation Lyophilized freeze dried protein
Protein Description Recombinant Rat Vascular Endothelial Growth Factor 164
Storage Lyophilized samples are stable for greater than six months at –20°C to -70°C.
Reconstituted VEGF164 should be stored in working aliquots at -20°C.
Avoid repeated freeze-thaw cycles!
Stability Stable for at least 3 months from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001103803
Locus ID 83785
UniProt ID B5DEK7
Cytogenetics 9q12
Synonyms Vegf; VEGF-A; VEGF111; VEGF164; VPF
Summary This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. [provided by RefSeq, Nov 2015]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.