Gastric inhibitory polypeptide Human Protein
Product Images
Other products for "GIP"
Specifications
Product Data | |
Species | Human |
Expression cDNA Clone or AA Sequence |
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH (1-letter code).
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH (3-letter code). |
Predicted MW | 4983.57 Da |
Purity | >95% by HPLC |
Buffer | State: Lyophilized purified peptide |
Preparation | Lyophilized purified peptide |
Protein Description | Human Gastric Inhibitory Peptide. Formula: C226H338N60O66S |
Storage | Upon receipt, store undiluted (in aliquots) at -20°C. Avoid repeated freezing and thawing. |
Stability | Shelf life: One year from despatch. |
Reference Data | |
RefSeq | NP_004114 |
Locus ID | 2695 |
UniProt ID | P09681 |
Cytogenetics | 17q21.32 |
Synonyms | gastric inhibitory polypeptide; glucose-dependent insulinotropic polypeptide |
Summary | 'This gene encodes an incretin hormone and belongs to the glucagon superfamily. The encoded protein is important in maintaining glucose homeostasis as it is a potent stimulator of insulin secretion from pancreatic beta-cells following food ingestion and nutrient absorption. This gene stimulates insulin secretion via its G protein-coupled receptor activation of adenylyl cyclase and other signal transduction pathways. It is a relatively poor inhibitor of gastric acid secretion. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.