Gastric inhibitory polypeptide Human Protein

CAT#: AR31124PU-N

Gastric inhibitory polypeptide human protein, 0.5 mg

Specifications

Product Data

• Species: Human
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH (1-letter code).
  Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH (3-letter code).
• Predicted MW: 4983.57 Da
• Purity: >95% by HPLC
• Buffer: State: Lyophilized purified peptide
• Preparation: Lyophilized purified peptide
• Protein Description: Human Gastric Inhibitory Peptide.
  Formula: C₂₂₆H₃₃₈N₆₀O₆₆S
• Storage: Upon receipt, store undiluted (in aliquots) at -20°C.
  Avoid repeated freezing and thawing.
• Stability: Shelf life: One year from despatch.

Reference Data

• RefSeq: NP_004114
• Locus ID: 2695
• UniProt ID: P09681
• Cytogenetics: 17q21.32
• Synonyms: gastric inhibitory polypeptide; glucose-dependent insulinotropic polypeptide
• Summary: 'This gene encodes an incretin hormone and belongs to the glucagon superfamily. The encoded protein is important in maintaining glucose homeostasis as it is a potent stimulator of insulin secretion from pancreatic beta-cells following food ingestion and nutrient absorption. This gene stimulates insulin secretion via its G protein-coupled receptor activation of adenylyl cyclase and other signal transduction pathways. It is a relatively poor inhibitor of gastric acid secretion. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein