Corticoliberin Human, Rat Protein

CAT#: AR31126PU-L

Corticoliberin human, rat protein, 1.0 mg


USD 600.00

5 Days*

Size
    • 1 mg

Product Images

Specifications

Product Data
Species Human, Rat
Expression cDNA Clone or AA Sequence
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 (1-letter code).
Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 (3-letter code).
Predicted MW 4757.43 Da
Purity >95% by HPLC
Buffer State: Purified peptide
Preparation Purified peptide
Protein Description Human, Rat Corticotropin Releasing Factor.
Formula: C208H344N60O63S2
Storage Upon receipt, store undiluted (in aliquots) at -20°C.
Avoid repeated freezing and thawing.
Stability Shelf life: One year from despatch.
Reference Data
RefSeq NP_000747
Locus ID 1392
Cytogenetics 8q13.1
Synonyms CRF; CRH1
Summary 'This gene encodes a member of the corticotropin-releasing factor family. The encoded preproprotein is proteolytically processed to generate the mature neuropeptide hormone. In response to stress, this hormone is secreted by the paraventricular nucleus (PVN) of the hypothalamus, binds to corticotropin releasing hormone receptors and stimulates the release of adrenocorticotropic hormone from the pituitary gland. Marked reduction in this protein has been observed in association with Alzheimer's disease. Autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes, and is highly expressed in the placenta. In the placenta it is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of the hormone occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, this protein may act as a trigger for parturition. [provided by RefSeq, Nov 2015]'
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Long-term depression

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.