Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CRH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRH antibody is: synthetic peptide directed towards the C-terminal region of Human CRH. Synthetic peptide located within the following region: GGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLM |
Corticotropin-Releasing Factor (CRF), rabbit anti human/mouse/rat, polyclonal, diluted Antiserum for RIA.
| Applications | ELISA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr- Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln- Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 coupled to carrier protein. |
Rabbit polyclonal anti human / mouse / rat Corticotropin-Releasing Factor (CRF)
| Applications | ELISA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe- His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln- Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 coupled to carrier protein. |
Rabbit polyclonal anti CRF (ovine); neat antiserum
| Applications | ELISA |
| Reactivities | Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe- His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala- Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2 coupled to carrier protein. |
Corticotropin Releasing Factor (CRH) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mammalian |
| Conjugation | Unconjugated |
Guinea pig polyclonal anti human / mouse /rat Corticotropin-Releasing Factor (CRF)
| Applications | ELISA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe- His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln- Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 coupled to carrier protein. |
USD 450.00
2 Weeks
Corticotropin Releasing Factor (CRH) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
Corticotropin-Releasing Factor (CRF), rabbit anti human/mouse/rat, polyclonal, diluted Antiserum for RIA.
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly- Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu- Arg-Arg-His-OH, (Disulfide bond) coupled to carrier protein. |
CRF (hu, ms, rt); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe- His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln- Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 coupled to carrier protein. |
Rabbit Polyclonal Anti-CRH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CRH |
CRH rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CRH |
CRH Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-194 of human CRH (NP_000747.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CRH