Galectin-1 Human Protein

CAT#: AR31162PU-N

Galectin-1 human recombinant protein, 50 µg

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFN AHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKL PDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD
• Predicted MW: 14.5 kDa
• Purity: >95% by SDS-PAGE and Silver staining
• Buffer: Presentation State: Purified
  State: Lyophilized protein
• Reconstitution: 100 mM acetic acid to a concentration of 100 ng/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.
• Preparation: Lyophilized protein
• Protein Description: Recombinant Human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues.
• Storage: Store lyophilized at 2-8°C for 6 months or at -20°C long term.
  After reconstitution store the antibody undiluted at 2-8°C for one month
  or (in aliquots) at -20°C long term.
  Avoid repeated freezing and thawing.
• Stability: Shelf life: one year from despatch.

Reference Data

• RefSeq: NP_002296
• Locus ID: 3956
• UniProt ID: P09382, A0A384MR27
• Cytogenetics: 22q13.1
• Synonyms: GAL1; GBP
• Summary: 'The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome