Galectin-1 Human Protein
Product Images
Other products for "LGALS1"
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
ACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFN AHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKL PDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD
|
Predicted MW | 14.5 kDa |
Purity | >95% by SDS-PAGE and Silver staining |
Buffer | Presentation State: Purified State: Lyophilized protein |
Reconstitution | 100 mM acetic acid to a concentration of 100 ng/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use. |
Preparation | Lyophilized protein |
Protein Description | Recombinant Human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues. |
Storage | Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing. |
Stability | Shelf life: one year from despatch. |
Reference Data | |
RefSeq | NP_002296 |
Locus ID | 3956 |
UniProt ID | P09382, A0A384MR27 |
Cytogenetics | 22q13.1 |
Synonyms | GAL1; GBP |
Summary | 'The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.