VEGF-A (Isoform 165) Human Protein

CAT#: DA3514

VEGF-A (Isoform 165) human recombinant protein, 5 µg


USD 220.00

2 Weeks*

Size
    • 5 ug

Product Images

Other products for "VEGFA"

Specifications

Product Data
Species Human
Expression Host Insect
Expression cDNA Clone or AA Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Predicted MW 45 kDa
Purity >90% pure by SDS-PAGE.
Buffer Presentation State: Purified
State: Lyophilized purified protein.
Buffer System: 50 mM Acetic Acid without stabilizer.
Bioactivity Biological: The ED50 for stimulation of cell proliferation by Human umbilical vein endothelial  (HUVEC) cells has been determined to be in the range of 1-4 ng/ml.
Endotoxin < 1 EU/µg.
Reconstitution We recommend a quick spin followed by reconstitution in sterile water to a concentration not lower than 50 μg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
Preparation Lyophilized purified protein.
Protein Description Recombinant Human Vascular Endothelial Growth Factor VEGF165. 
Result by N-terminal sequencingAPMAEGG.
Note Centrifuge vials before opening!
Storage Store lyophilized at 2-8°C for 2 weeks or at -20°C long term.
After reconstitution store the protein (in aliquots) at -20°C.
Avoid repeated freezing and thawing.
Stability Shelf life of the lyophilized product at -20°C:  one year from despatch.
Reference Data
RefSeq NP_001020537
Locus ID 7422
UniProt ID P15692
Cytogenetics 6p21.1
Synonyms MVCD1; VEGF; VPF
Summary 'This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome. Allelic variants of this gene have been associated with microvascular complications of diabetes 1 (MVCD1) and atherosclerosis. Alternatively spliced transcript variants encoding different isoforms have been described. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. The levels of VEGF are increased during infection with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), thus promoting inflammation by facilitating recruitment of inflammatory cells, and by increasing the level of angiopoietin II (Ang II), one of two products of the SARS-CoV-2 binding target, angiotensin-converting enzyme 2 (ACE2). In turn, Ang II facilitates the elevation of VEGF, thus forming a vicious cycle in the release of inflammatory cytokines. [provided by RefSeq, Jun 2020]'
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Bladder cancer, Cytokine-cytokine receptor interaction, Focal adhesion, mTOR signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma, VEGF signaling pathway

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.