VEGF-C / Flt4-L Rat Protein

CAT#: DA3519X

VEGF-C / Flt4-L rat recombinant protein, 20 µg

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: Insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIHHHHHH
• Predicted MW: 15-20 kDa
• Purity: >90% pure by SDS-PAGE and visualised by silver stain
• Buffer: Presentation State: Purified
  State: Lyophilized purified protein
  Buffer System: 50mM Acetic Acid
  Stabilizer: BSA
• Bioactivity: Biological: Determined (i) by the ability to induce VEGFR-3/FLT-4 receptor phosphorylation in PAEC/VEGFR-3 cells and (ii) the VEGF-C-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC).
• Endotoxin: < 0.1 ng per µg of VEGF-C
• Reconstitution: The lyophilized VEGF-C is soluble in water and most aqueous buffers.
  Restore in PBS or medium to a concentration not lower than 50 µg/ml.
• Preparation: Lyophilized purified protein
• Protein Description: The recombinant Rat VEGF-C contains 115 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 15-20 kDa protein in SDS-PAGE under reducing conditions.
• Storage: Store lyophilized at 2-8°C for 6 months or at -20°C long term.
  After reconstitution store the antibody undiluted at 2-8°C for one month
  or (in aliquots) at -20°C long term.
  Avoid repeated freezing and thawing.
• Stability: Shelf life: one year from despatch.

Reference Data

• RefSeq: NP_446105
• Locus ID: 114111
• UniProt ID: O35757
• Cytogenetics: 16p11
• Summary: platelet-derived growth factor/vascular derived growth factor (PDGF/VEGF); active in angiogenesis and endothelial cell growth [RGD, Feb 2006]