LYVE-1 Human Protein

CAT#: DA3525

LYVE-1 human recombinant protein, 20 µg


USD 210.00

2 Weeks*

Size
    • 20 ug

Product Images

Other products for "LYVE1"

Specifications

Product Data
Species Human
Expression Host Insect
Expression cDNA Clone or AA Sequence
SLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGHHHHHH
Predicted MW 45 kDa
Purity >95% by SDS-PAGE and visualised by silver stain
Buffer Presentation State: Purified
State: Lyophilized protein
Buffer System: PBS
Stabilizer: None
Endotoxin < 0.1 ng per µg of VEGF-C
Reconstitution The lyophilized sLYVE-1 is soluble in water and most aqueous buffers.
It should be restored in PBS or medium to a concentration not lower than 50 µg/ml.
Preparation Lyophilized protein
Protein Description A DNA sequence encoding the extracellular domain of human LYVE-1 (Met1 to Gly232) was fused to a C-terminal His-tag (6xHis) and expressed in insect cells. Based on N-terminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ser24. 
Result by N-terminal sequencing: SLRAEELSI
Length: 215 amino acids
Storage Prior to and following reconstitution store at -20°C.
Avoid repeated freezing and thawing.
Stability Shelf life: six months from despatch.
Reference Data
RefSeq NP_006682
Locus ID 10894
UniProt ID Q9Y5Y7, B2R672
Cytogenetics 11p15.4
Synonyms CRSBP-1; HAR; LYVE-1; XLKD1
Summary This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.