LYVE-1 Human Protein

CAT#: DA3525

LYVE-1 human recombinant protein, 20 µg

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: Insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  SLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGHHHHHH
• Predicted MW: 45 kDa
• Purity: >95% by SDS-PAGE and visualised by silver stain
• Buffer: Presentation State: Purified
  State: Lyophilized protein
  Buffer System: PBS
  Stabilizer: None
• Endotoxin: < 0.1 ng per µg of VEGF-C
• Reconstitution: The lyophilized sLYVE-1 is soluble in water and most aqueous buffers.
  It should be restored in PBS or medium to a concentration not lower than 50 µg/ml.
• Preparation: Lyophilized protein
• Protein Description: A DNA sequence encoding the extracellular domain of human LYVE-1 (Met1 to Gly232) was fused to a C-terminal His-tag (6xHis) and expressed in insect cells. Based on N-terminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ser24.
  Result by N-terminal sequencing: SLRAEELSI
  Length: 215 amino acids
• Storage: Prior to and following reconstitution store at -20°C.
  Avoid repeated freezing and thawing.
• Stability: Shelf life: six months from despatch.

Reference Data

• RefSeq: NP_006682
• Locus ID: 10894
• UniProt ID: Q9Y5Y7, B2R672
• Cytogenetics: 11p15.4
• Synonyms: CRSBP-1; HAR; LYVE-1; XLKD1
• Summary: This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane