Interleukin-1 beta / IL-1B Human Protein
Other products for "IL1B"
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQANMPVFLGGTKGGQDITDFTMQFVSS
|
| Predicted MW | 17.0 kDa |
| Purity | >98% pure by SDS-PAGE and Silver stain |
| Buffer | Presentation State: Purified State: Lyophilized purified protein Buffer System: PBS Stabilizer: None |
| Bioactivity | Biological: Measured in a cell proliferation assay using murine D10G4.1 cells. The ED50 for this effect is typically 2-10 pg/ml. |
| Endotoxin | < 0.1 ng per µg (IEU/µg) of rh IL-1beta |
| Reconstitution | The lyophilized rh IL-1beta is soluble in water and most aqueous buffers. The lyophilized powder can be restored in water to a concentration of 0.1 mg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use. |
| Preparation | Lyophilized purified protein |
| Protein Description | Recombinant Human Interleukin-1beta produced in E.Coli is a non-glycosylated, Interleukin-1 beta Polypeptide chain containing 153 amino acids and having a molecular mass of 17.0 kDa. Result by N-terminal sequencing: APVRSL and MAPVRS |
| Note | Range: 0.1-10.0 ng/ml |
| Storage | Store lyophilized at RT for 3 weeks or (preferably in a desiccator) at -20°C for longer. Following reconstitution store the antibody undiluted at 2-8°C for one week or (in aliquots) at -20°C for longer. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) Avoid repeated freezing and thawing. |
| Stability | Shelf life: one year from despatch. |
| Reference Data | |
| RefSeq | NP_000567 |
| Locus ID | 3553 |
| UniProt ID | P01584 |
| Cytogenetics | 2q14.1 |
| Synonyms | IL-1; IL1-BETA; IL1beta; IL1F2 |
| Summary | 'The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. Similarly, IL-1B has been implicated in human osteoarthritis pathogenesis. Patients with severe Coronavirus Disease 2019 (COVID-19) present elevated levels of pro-inflammatory cytokines such as IL-1B in bronchial alveolar lavage fluid samples. The lung damage induced by the Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is to a large extent, a result of the inflammatory response promoted by cytokines such as IL-1B. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2020]' |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Alzheimer's disease, Apoptosis, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Graft-versus-host disease, Hematopoietic cell lineage, MAPK signaling pathway, NOD-like receptor signaling pathway, Prion diseases, Toll-like receptor signaling pathway, Type I diabetes mellitus |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China