ITGB3BP (NM_014288) Human Recombinant Protein

CAT#: TP300064

Recombinant protein of human integrin beta 3 binding protein (beta3-endonexin) (ITGB3BP)

Product Images

Coomassie blue staining of purified ITGB3BP protein (Cat# TP300064). The protein was produced from HEK293T cells transfected with ITGB3BP cDNA clone (Cat# RC200064) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200064 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHP
  SLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK
  ELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055103
• Locus ID: 23421
• UniProt ID: Q13352
• Cytogenetics: 1p31.3
• Refseq Size: 1019
• Refseq ORF: 531
• Synonyms: CENP-R; CENPR; HSU37139; NRIF3; TAP20
• Summary: This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors