CINP (NM_032630) Human Recombinant Protein
CAT#: TP300085
Recombinant protein of human cyclin-dependent kinase 2-interacting protein (CINP)
View other "CINP" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200085 protein sequence
Red=Cloning site Green=Tags(s) MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSS PASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTW PTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHR AL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116019 |
Locus ID | 51550 |
UniProt ID | Q9BW66, A0A024R6M9 |
Cytogenetics | 14q32.31 |
Refseq Size | 996 |
Refseq ORF | 636 |
Summary | The protein encoded by this gene is reported to be a component of the DNA replication complex as well as a genome-maintenance protein. It may interact with proteins important for replication initiation and has been shown to bind chromatin at the G1 phase of the cell cycle and dissociate from chromatin with replication initiation. It may also serve to regulate checkpoint signaling as part of the DNA damage response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403179 | CINP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403179 | Transient overexpression lysate of cyclin-dependent kinase 2 interacting protein (CINP) |
USD 396.00 |
|
PH300085 | CINP MS Standard C13 and N15-labeled recombinant protein (NP_116019) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review