SKIP (INPP5K) (NM_016532) Human Recombinant Protein

CAT#: TP300092

Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1

Product Images

Coomassie blue staining of purified INPP5K protein (Cat# TP300092). The protein was produced from HEK293T cells transfected with INPP5K cDNA clone (Cat# RC200092) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200092 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFND
  SWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYG
  YYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIK
  NRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPC
  AGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYS
  STSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR
  SVVGISRPFQIPPGSLREDPLGEAQPQI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 50.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057616
• Locus ID: 51763
• UniProt ID: Q9BT40
• Cytogenetics: 17p13.3
• Refseq Size: 3001
• Refseq ORF: 1344
• Synonyms: MDCCAID; PPS; SKIP
• Summary: This gene encodes a protein with 5-phosphatase activity toward polyphosphate inositol. The protein localizes to the cytosol in regions lacking actin stress fibers. It is thought that this protein may negatively regulate the actin cytoskeleton. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008]
• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: Inositol phosphate metabolism, Insulin signaling pathway, Metabolic pathways, Phosphatidylinositol signaling system