FAIM2 (NM_012306) Human Recombinant Protein
CAT#: TP300196
Recombinant protein of human Fas apoptotic inhibitory molecule 2 (FAIM2)
View other "FAIM2" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200196 protein sequence
Red=Cloning site Green=Tags(s) MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDP SSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGW YWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVT VFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNR RHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036438 |
Locus ID | 23017 |
UniProt ID | Q9BWQ8 |
Cytogenetics | 12q13.12 |
Refseq Size | 4744 |
Refseq ORF | 948 |
Synonyms | LFG; LFG2; NGP35; NMP35; TMBIM2 |
Summary | Antiapoptotic protein which protects cells uniquely from Fas-induced apoptosis. Regulates Fas-mediated apoptosis in neurons by interfering with caspase-8 activation. May play a role in cerebellar development by affecting cerebellar size, internal granular layer (IGL) thickness, and Purkinje cell (PC) development.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415867 | FAIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415867 | Transient overexpression lysate of Fas apoptotic inhibitory molecule 2 (FAIM2) |
USD 396.00 |
|
PH300196 | FAIM2 MS Standard C13 and N15-labeled recombinant protein (NP_036438) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review