FAIM2 (NM_012306) Human Recombinant Protein

CAT#: TP300196

Recombinant protein of human Fas apoptotic inhibitory molecule 2 (FAIM2)

Product Images

Coomassie blue staining of purified FAIM2 protein (Cat# TP300196). The protein was produced from HEK293T cells transfected with FAIM2 cDNA clone (Cat# RC200196) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200196 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDP
  SSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGW
  YWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVT
  VFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNR
  RHSLSPEEYIFGALNIYLDIIYIFTFFLQLFGTNRE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036438
• Locus ID: 23017
• UniProt ID: Q9BWQ8
• Cytogenetics: 12q13.12
• Refseq Size: 4744
• Refseq ORF: 948
• Synonyms: LFG; LFG2; NGP35; NMP35; TMBIM2
• Summary: Antiapoptotic protein which protects cells uniquely from Fas-induced apoptosis. Regulates Fas-mediated apoptosis in neurons by interfering with caspase-8 activation. May play a role in cerebellar development by affecting cerebellar size, internal granular layer (IGL) thickness, and Purkinje cell (PC) development.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane