Calnexin (CANX) (NM_001746) Human Recombinant Protein
CAT#: TP300229
Recombinant protein of human calnexin (CANX), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200229 protein sequence
Red=Cloning site Green=Tags(s) MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVY FADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFL FDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPK TGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPE DRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEW EAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILT VALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDG GTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 65.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001737 |
Locus ID | 821 |
UniProt ID | P27824 |
Cytogenetics | 5q35.3 |
Refseq Size | 4953 |
Refseq ORF | 1776 |
Synonyms | CNX; IP90; P90 |
Summary | This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2018] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Antigen processing and presentation |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419769 | CANX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422525 | CANX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419769 | Transient overexpression lysate of calnexin (CANX), transcript variant 1 |
USD 396.00 |
|
LY422525 | Transient overexpression lysate of calnexin (CANX), transcript variant 2 |
USD 396.00 |
|
PH300229 | CANX MS Standard C13 and N15-labeled recombinant protein (NP_001737) |
USD 2,055.00 |
|
TP720461 | Recombinant protein of human calnexin (CANX), transcript variant 2 |
USD 330.00 |
|
TP760886 | Purified recombinant protein of Human calnexin (CANX), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review