HRASLS3 (PLA2G16) (NM_007069) Human Recombinant Protein

CAT#: TP300242

Recombinant protein of human phospholipase A2, group XVI (PLA2G16), transcript variant 1

Product Images

Coomassie blue staining of purified PLAAT3 protein (Cat# TP300242). The protein was produced from HEK293T cells transfected with PLAAT3 cDNA clone (Cat# RC200242) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200242 representing NM_007069
  Red=Cloning site Green=Tags(s)
  
  MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG
  SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVA
  GMGLAAMSLIGVMFSRNKRQKQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_009000
• Locus ID: 11145
• UniProt ID: P53816, A0A024R561
• Cytogenetics: 11q12.3-q13.1
• Refseq Size: 1070
• Refseq ORF: 486
• Synonyms: AdPLA; H-REV107; H-REV107-1; HRASLS3; HREV107; HREV107-1; HREV107-3; HRSL3; PLA2G16; PLAAT-3
• Summary: Exhibits both phospholipase A1/2 and acyltransferase activities (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381, PubMed:26503625). Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381, PubMed:22923616). For most substrates, PLA1 activity is much higher than PLA2 activity (PubMed:19615464). Shows O-acyltransferase activity,catalyzing the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid (PubMed:19615464). Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC) and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE), forming N-acylphosphatidylethanolamine (NAPE), which serves as precursor for N-acylethanolamines (NAEs) (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381). Exhibits high N-acyltransferase activity and low phospholipase A1/2 activity (PubMed:22825852).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane