HSP70-1A (HSPA1A) (NM_005345) Human Recombinant Protein
CAT#: TP300270
Recombinant protein of human heat shock 70kDa protein 1A (HSPA1A)
USD 447.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200270 representing NM_005345
Red=Cloning site Green=Tags(s) MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDA KRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVT NAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSIL TIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQA SLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLL QDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKG KISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGG SGSGPTIEEVD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 69.9 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | Higher specific activity than E. coli derived HSP70: Origene human recombinant Hsp70 (TP300270) was compared side-by-side with E. coli derived Hsp70 in a firefly luciferase refolding assay. Percentage of refolding is relative to an identical load of non-denatured luciferase in the reaction. The human cell produced Hsp70 is approximately 30% more active than the bacterial produced Hsp70 |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005336 |
| Locus ID | 3303 |
| UniProt ID | P08107, P0DMV8, P0DMV9, A8K5I0, B3KTT5 |
| Cytogenetics | 6p21.33 |
| Refseq Size | 2383 |
| Refseq ORF | 1923 |
| Synonyms | HEL-S-103; HSP70-1; HSP70-1A; HSP70-2; HSP70.1; HSP70.2; HSP70I; HSP72; HSPA1 |
| Summary | This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which encode similar proteins. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Antigen processing and presentation, Endocytosis, MAPK signaling pathway, Prion diseases, Spliceosome |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401646 | HSPA1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401646 | Transient overexpression lysate of heat shock 70kDa protein 1A (HSPA1A) |
USD 436.00 |
|
| PH300270 | HSPA1A MS Standard C13 and N15-labeled recombinant protein (NP_005336) |
USD 2,055.00 |
|
| TP710001 | Recombinant protein of human heat shock 70kDa protein 1A (HSPA1A), full length, with C-terminal polyhistidine tag, expressed in sf9 cells. |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China