GPIP137 (CAPRIN1) (NM_005898) Human Recombinant Protein

CAT#: TP300300

Recombinant protein of human cell cycle associated protein 1 (CAPRIN1), transcript variant 1

Product Images

Caprin1 interacts with inactive PKR. Purified Caprin1 (OriGene TP300300) was incubated with inactive PKR (PKR) or active PKR (P-PKR), immunoprecipitated with either nonspecific IgG or caprin1 antibodies, and analyzed by Western blotting for caprin1 or total PKR with corresponding antibodies. Figure cited from MBio, PMID: 25784705

• 

  Coomassie blue staining of purified CAPRIN1 protein (Cat# TP300300). The protein was produced from HEK293T cells transfected with CAPRIN1 cDNA clone (Cat# RC200300) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200300 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPSATSHSGSGSKSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAMKQILGVIDKKLRNLEK
  KKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREE
  AEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHA
  SIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHNHQNGLCEEEEAASAPAVEDQVPEAEPEPA
  EEYTEQSEVESTEYVNRQFMAETQFTSGEKEQVDEWTVETVEVVNSLQQQPQAASPSVPEPHSLTPVAQA
  DPLVRRQRVQDLMAQMQGPYNFIQDSMLDFENQTLDPAIVSAQPMNPTQNMDMPQLVCPPVHSESRLAQP
  NQVPVQPEATQVPLVSSTSEGYTASQPLYQPSHATEQRPQKEPIDQIQATISLNTDQTTASSSLPAASQP
  QVFQAGTSKPLHSSGINVNAAPFQSMQTVFNMNAPVPPVNEPETLKQQNQYQASYNQSFSSQPHQVEQTE
  LQQEQLQTVVGTYHGSPDQSHQVTGNHQQPPQQNTGFPRSNQPYYNSRGVSRGGSRGARGLMNGYRGPAN
  GFRGGYDGYRPSFSNTPNSGYTQSQFSAPRDYSGYQRDGYQQNFKRGSGQSGPRGAPRGRGGPPRPNRGM
  PQMNTQQVN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 78.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Co-immunoprecipitation (PMID: 25784705)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005889
• Locus ID: 4076
• UniProt ID: Q14444
• Cytogenetics: 11p13
• Refseq Size: 5562
• Refseq ORF: 2127
• Synonyms: GPIAP1; GPIP137; GRIP137; M11S1; p137GPI; RNG105
• Summary: May regulate the transport and translation of mRNAs of proteins involved in synaptic plasticity in neurons and cell proliferation and migration in multiple cell types. Binds directly and selectively to MYC and CCND2 RNAs. In neuronal cells, directly binds to several mRNAs associated with RNA granules, including BDNF, CAMK2A, CREB1, MAP2, NTRK2 mRNAs, as well as to GRIN1 and KPNB1 mRNAs, but not to rRNAs.[UniProtKB/Swiss-Prot Function]