TXNL1 (NM_004786) Human Recombinant Protein

CAT#: TP300344

Recombinant protein of human thioredoxin-like 1 (TXNL1), transcript variant 1

Product Images

Coomassie blue staining of purified TXNL1 protein (Cat# TP300344). The protein was produced from HEK293T cells transfected with TXNL1 cDNA clone (Cat# RC200344) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200344 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAAT
  NNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNE
  SDEHGFDNCLRKDTTFLESDCDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAE
  RSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKR
  VVGKKGESH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004777
• Locus ID: 9352
• UniProt ID: O43396, V9HW51
• Cytogenetics: 18q21.31
• Refseq Size: 1329
• Refseq ORF: 867
• Synonyms: HEL-S-114; TRP32; Txl; TXL-1; TXNL
• Summary: Active thioredoxin with a redox potential of about -250 mV.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome