ERH (NM_004450) Human Recombinant Protein

CAT#: TP300367

Recombinant protein of human enhancer of rudimentary homolog (Drosophila) (ERH)

Product Images

Coomassie blue staining of purified ERH protein (Cat# TP300367). The protein was produced from HEK293T cells transfected with ERH cDNA clone (Cat# RC200367) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200367 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCL
  VYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004441
• Locus ID: 2079
• UniProt ID: P84090, A0A024R6D4
• Cytogenetics: 14q24.1
• Refseq Size: 801
• Refseq ORF: 312
• Synonyms: DROER
• Summary: May have a role in the cell cycle.[UniProtKB/Swiss-Prot Function]