VAMP8 (NM_003761) Human Recombinant Protein

CAT#: TP300405

Recombinant protein of human vesicle-associated membrane protein 8 (endobrevin) (VAMP8)

Product Images

Coomassie blue staining of purified VAMP8 protein (Cat# TP300405). The protein was produced from HEK293T cells transfected with VAMP8 cDNA clone (Cat# RC200405) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200405 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFW
  WKNVKMIVLICVIVFIIILFIVLFATGAFS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003752
• Locus ID: 8673
• UniProt ID: Q9BV40
• Cytogenetics: 2p11.2
• Refseq Size: 790
• Refseq ORF: 300
• Synonyms: EDB; VAMP-8
• Summary: This gene encodes an integral membrane protein that belongs to the synaptobrevin/vesicle-associated membrane protein subfamily of soluble N-ethylmaleimide-sensitive factor attachment protein receptors (SNAREs). The encoded protein is involved in the fusion of synaptic vesicles with the presynaptic membrane.[provided by RefSeq, Jun 2010]
• Protein Families: Stem cell - Pluripotency, Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport