CKS2 (NM_001827) Human Recombinant Protein
CAT#: TP300491
Recombinant protein of human CDC28 protein kinase regulatory subunit 2 (CKS2)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200491 protein sequence
Red=Cloning site Green=Tags(s) MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFR RPLPKDQQK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001818 |
Locus ID | 1164 |
UniProt ID | P33552 |
Cytogenetics | 9q22.2 |
Refseq Size | 627 |
Refseq ORF | 237 |
Synonyms | CKSHS2 |
Summary | CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419728 | CKS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419728 | Transient overexpression lysate of CDC28 protein kinase regulatory subunit 2 (CKS2) |
USD 325.00 |
|
PH300491 | CKS2 MS Standard C13 and N15-labeled recombinant protein (NP_001818) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review