LEPROTL1 (NM_015344) Human Recombinant Protein

CAT#: TP300535

Purified recombinant protein of Homo sapiens leptin receptor overlapping transcript-like 1 (LEPROTL1), transcript variant 1

Product Images

Coomassie blue staining of purified LEPROTL1 protein (Cat# TP300535). The protein was produced from HEK293T cells transfected with LEPROTL1 cDNA clone (Cat# RC200535) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200535 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNACKELA
  IFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQW
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056159
• Locus ID: 23484
• UniProt ID: O95214, Q6FHL7
• Cytogenetics: 8p12
• Refseq Size: 2721
• Refseq ORF: 393
• Synonyms: HSPC112; my047; Vps55
• Summary: Negatively regulates growth hormone (GH) receptor cell surface expression in liver. May play a role in liver resistance to GH during periods of reduced nutrient availability.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane