LEPROTL1 (NM_015344) Human Recombinant Protein
CAT#: TP300535
Purified recombinant protein of Homo sapiens leptin receptor overlapping transcript-like 1 (LEPROTL1), transcript variant 1
View other "LEPROTL1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200535 protein sequence
Red=Cloning site Green=Tags(s) MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNACKELA IFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056159 |
Locus ID | 23484 |
UniProt ID | O95214, Q6FHL7 |
Cytogenetics | 8p12 |
Refseq Size | 2721 |
Refseq ORF | 393 |
Synonyms | HSPC112; my047; Vps55 |
Summary | Negatively regulates growth hormone (GH) receptor cell surface expression in liver. May play a role in liver resistance to GH during periods of reduced nutrient availability.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402424 | LEPROTL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402424 | Transient overexpression lysate of leptin receptor overlapping transcript-like 1 (LEPROTL1), transcript variant 1 |
USD 396.00 |
|
PH300535 | LEPROTL1 MS Standard C13 and N15-labeled recombinant protein (NP_056159) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review