LEPROTL1 Rabbit Polyclonal Antibody

CAT#: TA331958

Rabbit Polyclonal Anti-LEPROTL1 Antibody

Product Images

Host: Rabbit; Target Name: LEPROTL1; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: LEPROTL1; Sample Tissue: Human HepG2; Antibody Dilution: 1.0ug/ml; LEPROTL1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  Host: Rabbit; Target Name: LEPROTL1; Sample Tissue: Human 721_B; Antibody Dilution: 1.0ug/ml; LEPROTL1 is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Host: Rabbit; Target Name: LEPROTL1; Sample Tissue: Human Hela; Antibody Dilution: 1.0ug/ml; LEPROTL1 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LEPROTL1 Antibody is: synthetic peptide directed towards the N-terminal region of Human LEPROTL1. Synthetic peptide located within the following region: FVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: leptin receptor overlapping transcript-like 1
• Database Link:
  NP_056159
  Entrez Gene 23484 Human
  UniProt ID O95214
• Background: LEPROTL1 negatively regulates growth hormone (GH) receptor cell surface expression in liver. It may play a role in liver resistance to GH during periods of reduced nutrient availability.
• Synonyms: HSPC112; my047; Vps55
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane