GDI2 (NM_001494) Human Recombinant Protein
CAT#: TP300596
Recombinant protein of human GDP dissociation inhibitor 2 (GDI2), transcript variant 1
View other "GDI2" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200596 protein sequence
Red=Cloning site Green=Tags(s) MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGR DWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRF RKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIK LYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQL ICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYI AIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNI YKRMTGSEFDFEEMKRKKNDIYGED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001485 |
Locus ID | 2665 |
UniProt ID | P50395, Q6IAT1 |
Cytogenetics | 10p15.1 |
Refseq Size | 2441 |
Refseq ORF | 1335 |
Synonyms | HEL-S-46e; RABGDIB |
Summary | GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400572 | GDI2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426526 | GDI2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400572 | Transient overexpression lysate of GDP dissociation inhibitor 2 (GDI2), transcript variant 1 |
USD 396.00 |
|
LY426526 | Transient overexpression lysate of GDP dissociation inhibitor 2 (GDI2), transcript variant 2 |
USD 396.00 |
|
PH300596 | GDI2 MS Standard C13 and N15-labeled recombinant protein (NP_001485) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review