TMED9 (NM_017510) Human Recombinant Protein
CAT#: TP300652
Recombinant protein of human transmembrane emp24 protein transport domain containing 9 (TMED9)
USD 415.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200652 protein sequence
Red=Cloning site Green=Tags(s) MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYD KQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVH LDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQ TLILVAIGVWQMRHLKSFFEAKKLV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_059980 |
Locus ID | 54732 |
UniProt ID | Q9BVK6, A0A024R7M0 |
Cytogenetics | 5q35.3 |
Refseq Size | 1402 |
Refseq ORF | 705 |
Synonyms | GMP25; HSGP25L2G; p24a2; p24alpha2; p25 |
Summary | This gene is a member of a family of genes encoding transport proteins located in the endoplasmic reticulum and the Golgi. A similar gene in mouse is the target of microRNA miR-296, which is part of an imprinted cluster. [provided by RefSeq, Jul 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402594 | TMED9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402594 | Transient overexpression lysate of transmembrane emp24 protein transport domain containing 9 (TMED9) |
USD 325.00 |
|
PH300652 | TMED9 MS Standard C13 and N15-labeled recombinant protein (NP_059980) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review