CD79B (NM_001039933) Human Recombinant Protein

CAT#: TP300665

Recombinant protein of human CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 3

Product Images

Coomassie blue staining of purified CD79B protein (Cat# TP300665). The protein was produced from HEK293T cells transfected with CD79B cDNA clone (Cat# RC200665) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200665 representing NM_001039933
  Red=Cloning site Green=Tags(s)
  
  MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSA
  SGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTEL
  RVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDI
  VTLRTGEVKWSVGEHPGQE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001035022
• Locus ID: 974
• UniProt ID: P40259
• Cytogenetics: 17q23.3
• Refseq Size: 1303
• Refseq ORF: 1428
• Synonyms: AGM6; B29; IGB
• Summary: The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: B cell receptor signaling pathway