NME2 (NM_001018139) Human Recombinant Protein
CAT#: TP300680
Recombinant protein of human non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 4
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200680 protein sequence
Red=Cloning site Green=Tags(s) MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNS GPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELV DYKSCAHDWVYE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001018149 |
Locus ID | 4831 |
UniProt ID | P22392, Q6FHN3 |
Cytogenetics | 17q21.33 |
Refseq Size | 682 |
Refseq ORF | 456 |
Synonyms | NDKB; NDPK-B; NDPKB; NM23-H2; NM23B; PUF |
Summary | Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Metabolic pathways, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419276 | NME2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422664 | NME2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422665 | NME2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422666 | NME2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425432 | NME2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425433 | NME2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419276 | Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 1 |
USD 396.00 |
|
LY422664 | Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 2 |
USD 396.00 |
|
LY422665 | Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 3 |
USD 396.00 |
|
LY422666 | Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 4 |
USD 396.00 |
|
LY425432 | Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 2 |
USD 396.00 |
|
LY425433 | Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 3 |
USD 396.00 |
|
PH300680 | NME2 MS Standard C13 and N15-labeled recombinant protein (NP_001018149) |
USD 2,055.00 |
|
TP760412 | Purified recombinant protein of Human non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
|
TP761637 | Purified recombinant protein of Human non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review