FKBP52 (FKBP4) (NM_002014) Human Recombinant Protein
CAT#: TP300713
Recombinant protein of human FK506 binding protein 4, 59kDa (FKBP4)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200713 protein sequence
Red=Cloning site Green=Tags(s) MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSS LDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGE DLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQR MEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVY FKEGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDS NNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAE EENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVETEA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 51.6 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002005 |
| Locus ID | 2288 |
| UniProt ID | Q02790 |
| Cytogenetics | 12p13.33 |
| Refseq Size | 3757 |
| Refseq ORF | 1377 |
| Synonyms | FKBP51; FKBP52; FKBP59; HBI; Hsp56; p52; PPIase |
| Summary | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It has high structural and functional similarity to FK506-binding protein 1A (FKBP1A), but unlike FKBP1A, this protein does not have immunosuppressant activity when complexed with FK506. It interacts with interferon regulatory factor-4 and plays an important role in immunoregulatory gene expression in B and T lymphocytes. This encoded protein is known to associate with phytanoyl-CoA alpha-hydroxylase. It can also associate with two heat shock proteins (hsp90 and hsp70) and thus may play a role in the intracellular trafficking of hetero-oligomeric forms of the steroid hormone receptors. This protein correlates strongly with adeno-associated virus type 2 vectors (AAV) resulting in a significant increase in AAV-mediated transgene expression in human cell lines. Thus this encoded protein is thought to have important implications for the optimal use of AAV vectors in human gene therapy. The human genome contains several non-transcribed pseudogenes similar to this gene. [provided by RefSeq, Sep 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419585 | FKBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY419585 | Transient overexpression lysate of FK506 binding protein 4, 59kDa (FKBP4) |
USD 436.00 |
|
| PH300713 | FKBP4 MS Standard C13 and N15-labeled recombinant protein (NP_002005) |
USD 2,055.00 |
|
| TP721006 | Purified recombinant protein of Human FK506 binding protein 4, 59kDa (FKBP4) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China