TSPAN15 (NM_012339) Human Recombinant Protein

CAT#: TP300767

Recombinant protein of human tetraspanin 15 (TSPAN15)

Product Images

Coomassie blue staining of purified TSPAN15 protein (Cat# TP300767). The protein was produced from HEK293T cells transfected with TSPAN15 cDNA clone (Cat# RC200767) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200767 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGALVLSVGIYAEVERQKYKTLESAFLAPAIILILLG
  VVMFMVSFIGVLASLRDNLYLLQAFMYILGICLIMELIGGVVALTFRNQTIDFLNDNIRRGIENYYDDLD
  FKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACGVPYTCCIRNTTEVVNTMCGYKTIDKERFSV
  QDVIYVRGCTNAVIIWFMDNYTIMAGILLGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPS
  VEAAGTGCCLCYPN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036471
• Locus ID: 23555
• UniProt ID: O95858
• Cytogenetics: 10q22.1
• Refseq Size: 1726
• Refseq ORF: 882
• Synonyms: 2700063A19Rik; NET-7; NET7; TM4SF15
• Summary: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane