FAM110A (NM_001042353) Human Recombinant Protein
CAT#: TP300769
Recombinant protein of human family with sequence similarity 110, member A (FAM110A), transcript variant 3
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200769 protein sequence
Red=Cloning site Green=Tags(s) MPVHTLSPGAPSAPALPCRLRTRVPGYLLRGPADGGARKPSAVERLEADKAKYVKSLHVANTRQEPVQPL LSKQPLFSPETRRTVLTPSRRALPGPCRRPQLDLDILSSLIDLCDSPVSPAEASRTPGRAEGAGRPPPAT PPRPPPSTSAVRRVDVRPLPASPARPCPSPGPAAASSPARPPGLQRSKSDLSERFSRAAADLERFFNFCG LDPEEARGLGVAHLARASSDIVSLAGPSAGPGSSEGGCSRRSSVTVEERARERVPYGVSVVERNARVIKW LYGLRQARESPAAEG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035812 |
Locus ID | 83541 |
UniProt ID | Q9BQ89 |
Cytogenetics | 20p13 |
Refseq Size | 1827 |
Refseq ORF | 885 |
Synonyms | bA371L19.3; C20orf55; F10 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404054 | FAM110A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC410535 | FAM110A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420844 | FAM110A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425730 | FAM110A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429781 | FAM110A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY404054 | Transient overexpression lysate of family with sequence similarity 110, member A (FAM110A), transcript variant 2 |
USD 325.00 |
|
LY410535 | Transient overexpression lysate of family with sequence similarity 110, member A (FAM110A), transcript variant 1 |
USD 325.00 |
|
LY420844 | Transient overexpression lysate of family with sequence similarity 110, member A (FAM110A), transcript variant 3 |
USD 325.00 |
|
LY425730 | Transient overexpression lysate of family with sequence similarity 110, member A (FAM110A), transcript variant 3 |
USD 325.00 |
|
LY429781 | Transient overexpression lysate of family with sequence similarity 110, member A (FAM110A), transcript variant 1 |
USD 325.00 |
|
PH300769 | FAM110A MS Standard C13 and N15-labeled recombinant protein (NP_001035812) |
USD 2,055.00 |
|
PH301431 | FAM110A MS Standard C13 and N15-labeled recombinant protein (NP_997004) |
USD 2,055.00 |
|
TP301431 | Recombinant protein of human family with sequence similarity 110, member A (FAM110A), transcript variant 2 |
USD 823.00 |
|
TP761331 | Purified recombinant protein of Human family with sequence similarity 110, member A (FAM110A), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review