Germany
Japan
United Kingdom
China
FAM110A (NM_207121) Human Mass Spec Standard
CAT#: PH301431
FAM110A MS Standard C13 and N15-labeled recombinant protein (NP_997004)
Product Images
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201431 |
| Predicted MW | 31.3 kDa |
| Protein Sequence |
>RC201431 protein sequence
Red=Cloning site Green=Tags(s) MPVHTLSPGAPSAPALPCRLRTRVPGYLLRGPADGGARKPSAVERLEADKAKYVKSLHVANTRQEPVQPL LSKQPLFSPETRRTVLTPSRRALPGPCRRPQLDLDILSSLIDLCDSPVSPAEASRTPGRAEGAGRPPPAT PPRPPPSTSAVRRVDVRPLPASPARPCPSPGPAAASSPARPPGLQRSKSDLSERFSRAAADLERFFNFCG LDPEEARGLGVAHLARASSDIVSLAGPSAGPGSSEGGCSRRSSVTVEERARERVPYGVSVVERNARVIKW LYGLRQARESPAAEG myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_997004 |
| RefSeq Size | 1619 |
| RefSeq ORF | 885 |
| Synonyms | bA371L19.3; C20orf55; F10 |
| Locus ID | 83541 |
| UniProt ID | Q9BQ89 |
| Cytogenetics | 20p13 |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404054 | FAM110A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC410535 | FAM110A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC420844 | FAM110A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425730 | FAM110A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429781 | FAM110A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY404054 | Transient overexpression lysate of family with sequence similarity 110, member A (FAM110A), transcript variant 2 |
USD 396.00 |
|
| LY410535 | Transient overexpression lysate of family with sequence similarity 110, member A (FAM110A), transcript variant 1 |
USD 396.00 |
|
| LY420844 | Transient overexpression lysate of family with sequence similarity 110, member A (FAM110A), transcript variant 3 |
USD 396.00 |
|
| LY425730 | Transient overexpression lysate of family with sequence similarity 110, member A (FAM110A), transcript variant 3 |
USD 396.00 |
|
| LY429781 | Transient overexpression lysate of family with sequence similarity 110, member A (FAM110A), transcript variant 1 |
USD 396.00 |
|
| PH300769 | FAM110A MS Standard C13 and N15-labeled recombinant protein (NP_001035812) |
USD 2,055.00 |
|
| TP300769 | Recombinant protein of human family with sequence similarity 110, member A (FAM110A), transcript variant 3 |
USD 823.00 |
|
| TP301431 | Recombinant protein of human family with sequence similarity 110, member A (FAM110A), transcript variant 2 |
USD 823.00 |
|
| TP761331 | Purified recombinant protein of Human family with sequence similarity 110, member A (FAM110A), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review