SPSB2 (NM_032641) Human Recombinant Protein

CAT#: TP300801

Recombinant protein of human splA/ryanodine receptor domain and SOCS box containing 2 (SPSB2)

Product Images

Coomassie blue staining of purified SPSB2 protein (Cat# TP300801). The protein was produced from HEK293T cells transfected with SPSB2 cDNA clone (Cat# RC200801) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200801 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRP
  VAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSNSESWGWDIGRGKL
  YHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQC
  QVRIRYLGERRAEPHSLLHLSRLCVRHNLGDTRLGQVSALPLPPAMKRYLLYQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_116030
• Locus ID: 84727
• UniProt ID: Q99619
• Cytogenetics: 12p13.31
• Refseq Size: 1272
• Refseq ORF: 789
• Synonyms: GRCC9; SSB2
• Summary: This gene encodes a member of a subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal suppressor of cytokine signaling (SOCS) box. This protein plays a role in cell signaling. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
• Protein Families: Druggable Genome