SPSB2 Rabbit Polyclonal Antibody

CAT#: TA343000

Rabbit Polyclonal Anti-SPSB2 Antibody

Product Images

WB Suggested Anti-SPSB2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

• 

  Sample Type: Rhesus macaque spinal cord Primary Antibody Dilution: 1:300 Secondary Antibody: Donkey anti Rabbit 488 Secondary Antibody Dilution: 1:500 Color/Signal Descriptions: Green: SPSB2 Gene Name: SPSB2 Submitted by: Timur Mavlyutov, Ph. D., Departme

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Rhesus macaque
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPSB2 antibody: synthetic peptide directed towards the N terminal of human SPSB2. Synthetic peptide located within the following region: KDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: splA/ryanodine receptor domain and SOCS box containing 2
• Database Link:
  NP_116030
  Entrez Gene 84727 Human
  UniProt ID Q99619
• Background: This gene encodes encodes a suppressor of cytokine signaling (SOCS) family member, and it belongs to the subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal SOCS box. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes.
• Synonyms: GRCC9; SSB2
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome