HSCB (NM_172002) Human Recombinant Protein
CAT#: TP300843
Recombinant protein of human HscB iron-sulfur cluster co-chaperone homolog (E. coli) (HSCB)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200843 representing NM_172002
Red=Cloning site Green=Tags(s) MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPT RDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLY LLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEE AKEILTKMRYFSNIEEKIKLKKIPL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.2 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_741999 |
| Locus ID | 150274 |
| UniProt ID | Q8IWL3, A0A384NYJ4 |
| Cytogenetics | 22q12.1 |
| Refseq Size | 1106 |
| Refseq ORF | 705 |
| Synonyms | DNAJC20; HSC20; JAC1 |
| Summary | This gene encodes a DnaJ-type co-chaperone and member of the heat shock cognate B (HscB) family of proteins. The encoded protein plays a role in the synthesis of iron-sulfur clusters, protein cofactors that are involved in the redox reactions of mitochondrial electron transport and other processes. Cells in which this gene is knocked down exhibit reduced activity of iron-sulfur cluster-dependent enzymes including succinate dehydrogenase and aconitase. The encoded protein may stimulate the ATPase activity of the mitochondrial stress-70 protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406803 | HSCB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY406803 | Transient overexpression lysate of HscB iron-sulfur cluster co-chaperone homolog (E. coli) (HSCB) |
USD 436.00 |
|
| PH300843 | HSCB MS Standard C13 and N15-labeled recombinant protein (NP_741999) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China