DCUN1D5 (NM_032299) Human Recombinant Protein

CAT#: TP300870

Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5)

Product Images

Coomassie blue staining of purified DCUN1D5 protein (Cat# TP300870). The protein was produced from HEK293T cells transfected with DCUN1D5 cDNA clone (Cat# RC200870) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200870 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGM
  EKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKN
  IYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHAD
  LSNYDEDGAWPVLLDEFVEWQKVRQTS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115675
• Locus ID: 84259
• UniProt ID: Q9BTE7, A0A024R3A2
• Cytogenetics: 11q22.3
• Refseq Size: 12732
• Refseq ORF: 711
• Synonyms: SCCRO5
• Summary: Contributes to the neddylation of all cullins by transfering NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which is necessary for the activation of cullin-RING E3 ubiquitin ligases (CRLs) (PubMed:26906416, PubMed:23201271, PubMed:19617556). May play a role in DNA damage response and may participate to cell proliferation and anchorage-independent cell growth (PubMed:23098533, PubMed:24192928).[UniProtKB/Swiss-Prot Function]