Vgl4 (VGLL4) (NM_014667) Human Recombinant Protein
CAT#: TP300886
Recombinant protein of human vestigial like 4 (Drosophila) (VGLL4), transcript variant 2
View other "VGLL4" proteins (11)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200886 protein sequence
Red=Cloning site Green=Tags(s) METPLDVLSRAASLVHADDEKREAALRGEPRMQTLPVASALSSHRTGPPPISPSKRKFSMEPGDEDLDCD NDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSL DASRPAGLSPTLTPGERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVE EHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMV SHSHSPSVVS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055482 |
Locus ID | 9686 |
UniProt ID | Q14135, A0A075B6E4 |
Cytogenetics | 3p25.3-p25.2 |
Refseq Size | 3756 |
Refseq ORF | 870 |
Synonyms | VGL-4 |
Summary | May act as a specific coactivator for the mammalian TEFs.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415121 | VGLL4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426931 | VGLL4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426933 | VGLL4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415121 | Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 2 |
USD 396.00 |
|
LY426931 | Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 1 |
USD 396.00 |
|
LY426933 | Transient overexpression lysate of vestigial like 4 (Drosophila) (VGLL4), transcript variant 4 |
USD 396.00 |
|
PH300886 | VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_055482) |
USD 2,055.00 |
|
PH325235 | VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_001121693) |
USD 2,055.00 |
|
PH325405 | VGLL4 MS Standard C13 and N15-labeled recombinant protein (NP_001121691) |
USD 2,055.00 |
|
TP325235 | Purified recombinant protein of Homo sapiens vestigial like 4 (Drosophila) (VGLL4), transcript variant 4 |
USD 748.00 |
|
TP325405 | Recombinant protein of human vestigial like 4 (Drosophila) (VGLL4), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review