NSE (ENO2) (NM_001975) Human Recombinant Protein

CAT#: TP301085

Recombinant protein of human enolase 2 (gamma, neuronal) (ENO2)

Product Images

Coomassie blue staining of purified ENO2 protein (Cat# TP301085). The protein was produced from HEK293T cells transfected with ENO2 cDNA clone (Cat# RC201085) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201085 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHIN
  STIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGN
  SDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDE
  GGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALY
  QDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSV
  TEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE
  ARFAGHNFRNPSVL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 47.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001966
• Locus ID: 2026
• UniProt ID: P09104, Q6FHV6
• Cytogenetics: 12p13.31
• Refseq Size: 2423
• Refseq ORF: 1302
• Synonyms: HEL-S-279; NSE
• Summary: This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates. [provided by RefSeq, Jul 2008]
• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation