Sigma1 receptor (SIGMAR1) (NM_005866) Human Recombinant Protein
CAT#: TP301206
Recombinant protein of human sigma non-opioid intracellular receptor 1 (SIGMAR1), transcript variant 1
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201206 protein sequence
Red=Cloning site Green=Tags(s) MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHP GHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGT TKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGL RLELTTYLFGQDP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.9 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005857 |
| Locus ID | 10280 |
| UniProt ID | Q99720 |
| Cytogenetics | 9p13.3 |
| Refseq Size | 1728 |
| Refseq ORF | 669 |
| Synonyms | ALS16; DSMA2; hSigmaR1; OPRS1; SIG-1R; sigma1R; SR-BP; SR-BP1; SRBP |
| Summary | This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms. [provided by RefSeq, Aug 2013] |
| Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401778 | SIGMAR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC407820 | SIGMAR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430170 | SIGMAR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401778 | Transient overexpression lysate of sigma non-opioid intracellular receptor 1 (SIGMAR1), transcript variant 1 |
USD 436.00 |
|
| LY407820 | Transient overexpression lysate of sigma non-opioid intracellular receptor 1 (SIGMAR1), transcript variant 2 |
USD 436.00 |
|
| LY430170 | Transient overexpression lysate of sigma non-opioid intracellular receptor 1 (SIGMAR1), transcript variant 2 |
USD 396.00 |
|
| PH301206 | SIGMAR1 MS Standard C13 and N15-labeled recombinant protein (NP_005857) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China