DTYMK (NM_012145) Human Recombinant Protein

CAT#: TP301228

Recombinant protein of human deoxythymidylate kinase (thymidylate kinase) (DTYMK)


  View other "DTYMK" proteins (5)

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


DTYMK mouse monoclonal antibody, clone OTI1G8 (formerly 1G8)
    • 100 ul

USD 379.00

Other products for "DTYMK"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC201228 protein sequence
Red=Cloning site Green=Tags(s)

MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHL
LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADA
AKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGEL
WK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.6 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_036277
Locus ID 1841
UniProt ID P23919, Q6FGU2
Cytogenetics 2q37.3
Refseq Size 1227
Refseq ORF 636
Synonyms CDC8; PP3731; TMPK; TYMK
Summary Catalyzes the conversion of dTMP to dTDP.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pyrimidine metabolism

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.