DTYMK (NM_012145) Human Mass Spec Standard

CAT#: PH301228

DTYMK MS Standard C13 and N15-labeled recombinant protein (NP_036277)

Product Images

Coomassie blue staining of purified DTYMK protein (Cat# TP301228). The protein was produced from HEK293T cells transfected with DTYMK cDNA clone (Cat# RC201228) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201228
• Predicted MW: 23.8 kDa
• Protein Sequence:
  Sequence Link

  >RC201228 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHL
  LFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADA
  AKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGEL
  WK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036277
• RefSeq Size: 1227
• RefSeq ORF: 636
• Synonyms: CDC8; PP3731; TMPK; TYMK
• Locus ID: 1841
• UniProt ID: P23919, Q6FGU2
• Cytogenetics: 2q37.3
• Summary: ''
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Pyrimidine metabolism